DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and lhx2a

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_017208320.1 Gene:lhx2a / 795283 ZFINID:ZDB-GENE-091118-109 Length:328 Species:Danio rerio


Alignment Length:248 Identity:76/248 - (30%)
Similarity:110/248 - (44%) Gaps:42/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHH--TCYVRNSKLYCKMDY--DRLFGVKC 334
            :|.|||..|.|||.:...:..|||:||.|..|...|..  ||:.::..:|||.||  .|....:|
Zfish    12 VCAGCGALISDRFYLLAAERRWHERCLKCSACQTDLESELTCFSKHGDIYCKEDYYSRRFSSQRC 76

  Fly   335 SSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRH----------- 388
            :.|...|...|:||| ..:.|:||.||.|..|...|..|:.:.:::..::|..|           
Zfish    77 ARCHLGISATEIVMR-ARDLVYHLSCFSCATCHKVLLTGDHYGMKETSVYCRAHIQRECHADLYY 140

  Fly   389 ---------------DLEKEMFLAA-------AAAQHCGFVGLDEEDL---LRPRDGRRGPKRPR 428
                           |.|..:..|.       :.|.|..: ..|..||   |..|...:..||.|
Zfish   141 SDMSSRETNSESHTYDEESPVHRARVRRRKNNSTADHIAY-SSDVSDLGVDLSERVSCQKSKRMR 204

  Fly   429 TILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKK 481
            |.....|.:..::.|..:..|..|..:.||:.|||:.||:||||||.|||.::
Zfish   205 TSFKHHQLRSMQSFFTHNHNPDAKDLKELAQKTGLTKRVLQVWFQNARAKFRR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 23/55 (42%)
LIM 333..388 CDD:295319 17/54 (31%)
Homeobox 427..480 CDD:278475 22/52 (42%)
lhx2aXP_017208320.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.