DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and lhx2b

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001035099.3 Gene:lhx2b / 791744 ZFINID:ZDB-GENE-051220-1 Length:427 Species:Danio rerio


Alignment Length:326 Identity:96/326 - (29%)
Similarity:138/326 - (42%) Gaps:75/326 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SADCSGRTEVGHIKCEKNF--------ELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLH 310
            ||..|...::|  :.|.|.        .||.|||.||.||:.:...|..||.:||.||.|.:.|.
Zfish    57 SATISSAIDMG--ETETNMPSISGDRVALCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLE 119

  Fly   311 H--TCYVRNSKLYCKMDYDRLFGV-KCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQK 372
            .  ||:.::..:|||.||.|.|.| :|:.|...|...|:||| ..:.|:||.||.|..|...|..
Zfish   120 SELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMR-ARDLVYHLNCFTCTTCNKMLTT 183

  Fly   373 GEQFMLRDGQLFCYRH----------------DLEKEMFLAAAAAQHCGFV-GLDEEDLLRPRDG 420
            |:.|.::|..::|..|                |:.....|::.......:. |::.....|||. 
Zfish   184 GDHFGMKDSLVYCRLHFETLIQGDFPTHFNHTDVAPNKGLSSTGPLGLSYYNGVNTVQKGRPRK- 247

  Fly   421 RRGP-----------------------------------KRPRTILTSQQRKQFKASFDQSPKPC 450
            |:.|                                   ||.||.....|.:..|:.|..:..|.
Zfish   248 RKSPGPGADLAAYNAALSCNENDGDPMDRDSQYSSSQKTKRMRTSFKHHQLRTMKSYFAINHNPD 312

  Fly   451 RKVREALAKDTGLSVRVVQVWFQNQRAKMKK-IQR-------KAKQNGGSGGGSGSGRGTGNSSA 507
            .|..:.||:.|||:.||:||||||.|||.:: :.|       ||.......||:.||..:..|:|
Zfish   313 AKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQENTGVDKASDGSNLAGGTPSGPASEISNA 377

  Fly   508 T 508
            :
Zfish   378 S 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 23/53 (43%)
LIM 333..388 CDD:295319 19/54 (35%)
Homeobox 427..480 CDD:278475 23/52 (44%)
lhx2bNP_001035099.3 LIM1_Lhx2 74..137 CDD:188853 23/62 (37%)
LIM2_Lhx2_Lhx9 142..200 CDD:188763 20/58 (34%)
COG5576 <267..389 CDD:227863 34/112 (30%)
Homeobox 290..342 CDD:278475 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.