DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and NKX2-4

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_149416.1 Gene:NKX2-4 / 644524 HGNCID:7837 Length:354 Species:Homo sapiens


Alignment Length:355 Identity:82/355 - (23%)
Similarity:102/355 - (28%) Gaps:160/355 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 SAAAVAAPSPAGTSVATSQLG----------GAVAAAIAAAAAAAAAATTPTSTGPAATGSGNAN 218
            :|||..||.|..:|.|.:..|          .|.|||.|||||||||||.....|.:....| |.
Human    44 AAAAYRAPPPGPSSQAATVAGMQPSHAMAGHNAAAAAAAAAAAAAAAATYHMPPGVSQFPHG-AM 107

  Fly   219 GSGNGNGNGN-GNGNGNGNGNGGGAATA--------SAAAASKLSADCSGRTEVGHIKCEKNFEL 274
            ||....|.|| |......:|..|||||.        ..::.|:.....:|..             
Human   108 GSYCNGGLGNMGELPAYTDGMRGGAATGWYGANPDPRYSSISRFMGPSAGVN------------- 159

  Fly   275 CEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHHTCYVRNSKLYCKMDYDRLFGVKCSSCCH 339
            ..|.|.      |..:.||                                      .|.....|
Human   160 VAGMGS------LTGIADA--------------------------------------AKSLGPLH 180

  Fly   340 AILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHC 404
            |                                                        |||||   
Human   181 A--------------------------------------------------------AAAAA--- 186

  Fly   405 GFVGLDEEDLLRPRDGRRGPKRPRTILTSQ-QRKQFKASFDQSPKPCRKVREALAKDTGLSVRVV 468
                              .|:|.|.:|.|| |..:.:..|.|........||.||....|:...|
Human   187 ------------------APRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQV 233

  Fly   469 QVWFQNQRAKMK-----KIQRKAKQNGGSG 493
            ::||||.|.|||     |..::.:|.||.|
Human   234 KIWFQNHRYKMKRQAKDKAAQQLQQEGGLG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 5/51 (10%)
LIM 333..388 CDD:295319 3/54 (6%)
Homeobox 427..480 CDD:278475 19/53 (36%)
NKX2-4NP_149416.1 Homeobox 192..245 CDD:278475 19/52 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 246..329 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.