DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and LMO3

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001230542.1 Gene:LMO3 / 55885 HGNCID:6643 Length:167 Species:Homo sapiens


Alignment Length:149 Identity:51/149 - (34%)
Similarity:68/149 - (45%) Gaps:31/149 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 CEGCGQKIHDRFLMNVGDANWHEQCL--ACCYCGMQLH------------HT----CYVRNSKL- 320
            |.||.:||.||:|:...|..|||.||  |||.|.:..|            ||    |......| 
Human    13 CAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEHLKRCGSIYIHAAHTEIGICVTLEWPLP 77

  Fly   321 YCKMDYDR------LFGV--KCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFM 377
            :..:|:.:      ||||  .|::|...|...|:|||...| |:||.||.|..|......|::|.
Human    78 FVIIDFSQQITIAWLFGVTGNCAACSKLIPAFEMVMRAKDN-VYHLDCFACQLCNQRFCVGDKFF 141

  Fly   378 LRDGQLFC---YRHDLEKE 393
            |::..:.|   |...|.||
Human   142 LKNNMILCQTDYEEGLMKE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 24/70 (34%)
LIM 333..388 CDD:295319 20/57 (35%)
Homeobox 427..480 CDD:278475
LMO3NP_001230542.1 LIM 13..>49 CDD:295319 18/35 (51%)
LIM2_LMO1_LMO3 99..153 CDD:188775 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.