DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and lhx6b

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_685757.5 Gene:lhx6b / 557579 ZFINID:ZDB-GENE-060531-41 Length:286 Species:Danio rerio


Alignment Length:224 Identity:76/224 - (33%)
Similarity:116/224 - (51%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHH--TCYVRNSKLYCKMDYDRLFGVKCSS 336
            :|.||..:|.||:::.|....||.:||.|..|.:.|.|  :|::||.:::|:.||:..||:||:.
Zfish    32 ICTGCSTEIFDRYVLKVNGLTWHLRCLQCSVCAVSLGHQNSCFIRNKEIFCRTDYNSTFGIKCAR 96

  Fly   337 CCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRH------DLEKEMF 395
            |.|.:...:.:.| ..|.::||.||.|:.|:..|..||:|.|.:.|:.|..|      :|::   
Zfish    97 CGHQVSANDWIRR-AGNDIYHLACFACFFCKRQLSTGEEFGLMENQVLCRVHYDITLLNLQQ--- 157

  Fly   396 LAAAAAQHCGFVGLDEEDLLRPRDGR-------RGPKRPRTILTSQQRKQFKASFDQSPKPCRKV 453
                         |.:...|...||.       :..|||||..||:|.:..:..|.:...|....
Zfish   158 -------------LSDNGNLIHLDGALPIQYLPKASKRPRTSFTSEQIQIMQTHFIRDKNPDAAT 209

  Fly   454 REALAKDTGLSVRVVQVWFQNQRAKMKKI 482
            .:.||..||||.||:||||||.||:.|:|
Zfish   210 LQRLADTTGLSRRVIQVWFQNCRARQKRI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 20/53 (38%)
LIM 333..388 CDD:295319 19/54 (35%)
Homeobox 427..480 CDD:278475 24/52 (46%)
lhx6bXP_685757.5 LIM 32..86 CDD:295319 19/53 (36%)
LIM 94..148 CDD:295319 18/54 (33%)
Homeobox 183..236 CDD:278475 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.