DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lmx1a and LIMS2

DIOPT Version :9

Sequence 1:	NP_729801.1	Gene:	Lmx1a / 39406	FlyBaseID:	FBgn0052105	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_060450.2	Gene:	LIMS2 / 55679	HGNCID:	16084	Length:	365	Species:	Homo sapiens

Alignment Length:	142	Identity:	38/142 - (26%)
Similarity:	61/142 - (42%)	Gaps:	12/142 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   252 KLSADCSGRTEVGHIKC-----EKNFELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQ-LH 310
            :|:|:  .|...|.:.|     :....:|..|.:.|..| ::|.....||.:...|..|... |.
Human   196 ELTAE--ARELKGELYCLPCHDKMGVPICGACRRPIEGR-VVNALGKQWHVEHFVCAKCEKPFLG 257

  Fly   311 HTCYVRNSKLYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQ 375
            |..|.:....||:..|::|||..|.:|.|.|  :..|:..: |..:.:.||.|..|...|....:
Human   258 HRHYEKKGLAYCETHYNQLFGDVCYNCSHVI--EGDVVSAL-NKAWCVSCFSCSTCNSKLTLKNK 319

  Fly   376 FMLRDGQLFCYR 387
            |:..|.:..|.|
Human   320 FVEFDMKPVCKR 331

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lmx1a	NP_729801.1	LIM1_Lmx1b	275..327	CDD:188757	14/52 (27%)
		LIM	333..388	CDD:295319	15/55 (27%)
		Homeobox	427..480	CDD:278475
LIMS2	NP_060450.2	LIM1_PINCH	39..97	CDD:188717
		LIM2_PINCH	100..151	CDD:188718
		LIM3_PINCH	164..214	CDD:188719	5/19 (26%)
		LIM4_PINCH	220..273	CDD:188720	14/53 (26%)
		LIM5_PINCH	281..334	CDD:188721	15/54 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910