DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lmx1a and hesx1

DIOPT Version :9

Sequence 1:	NP_729801.1	Gene:	Lmx1a / 39406	FlyBaseID:	FBgn0052105	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_001016712.1	Gene:	hesx1 / 549466	XenbaseID:	XB-GENE-483193	Length:	186	Species:	Xenopus tropicalis

Alignment Length:	142	Identity:	44/142 - (30%)
Similarity:	63/142 - (44%)	Gaps:	39/142 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   356 FHLPCFVCYACRLPLQ-------KGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEED 413
            :|:|..   :|.||:|       .||:..:|          |||          .||     |||
Frog    60 WHIPVI---SCDLPVQVHALRRSMGEETQVR----------LEK----------CCG-----EED 96

  Fly   414 LL---RPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQ 475
            .|   |.....|| :||||..|..|.:..:..|..:..|...:||.||....|....:|:||||:
Frog    97 RLTYKRELSWYRG-RRPRTAFTRSQIEILENVFRVNSYPGIDIREELAGKLALDEDRIQIWFQNR 160

  Fly   476 RAKMKKIQRKAK 487
            |||:|:..|:::
Frog   161 RAKLKRSHRESQ 172

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lmx1a	NP_729801.1	LIM1_Lmx1b	275..327	CDD:188757
		LIM	333..388	CDD:295319	9/38 (24%)
		Homeobox	427..480	CDD:278475	20/52 (38%)
hesx1	NP_001016712.1	Homeobox	112..166	CDD:365835	20/53 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910