DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and hoxb3

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:286 Identity:72/286 - (25%)
Similarity:101/286 - (35%) Gaps:82/286 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 QLFCY----RHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGP------KRPRTILTSQQR 436
            |:|.:    |.:.:::....|.||:.||              |.|.|      ||.||..||.|.
 Frog   118 QIFPWMKESRQNSKQKSSPPAPAAESCG--------------GDRSPPGSSASKRARTAYTSAQL 168

  Fly   437 KQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGGGS----- 496
            .:.:..|..:...||..|..:|....||.|.:::||||:|.|.||.|:....:..|||.|     
 Frog   169 VELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKVKGMSSSSGGASPTSTP 233

  Fly   497 -----------GSGRG-TGNSSATDDKDTNDKEDKCV----------KQELGGDSSGY----LGG 535
                       ||... |.|..|......|.......          :|:.|..::.|    |.|
 Frog   234 PLSMQSSAGFLGSMHSMTANYEAPSPPPFNKSHQNAYYQNPGKGCPSQQKYGNTAAEYDHHGLQG 298

  Fly   536 LDSTFASQPLNPNLPFSPDDYPANSNDSFCSSDLSLDGSNFDQLDDDADSLSLNNLELQSTSSSG 600
            ....:.|    ||:..||.....|..||..:....|.|              ||:|..|.|:...
 Frog   299 NGGAYVS----PNMQGSPVYVGGNYVDSVPAQGPPLYG--------------LNHLAHQPTNMDY 345

  Fly   601 N--------QHSHSHSNPHDMLANLN 618
            |        || |:..:||.....|:
 Frog   346 NGAPPMPASQH-HAPCDPHPTYTELS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 2/9 (22%)
Homeobox 427..480 CDD:278475 19/52 (37%)
hoxb3NP_001015971.1 Homeobox 160..212 CDD:306543 19/51 (37%)
DUF4074 325..384 CDD:315871 14/61 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.