powered by:
Protein Alignment Lmx1a and POU3F4
DIOPT Version :9
Sequence 1: | NP_729801.1 |
Gene: | Lmx1a / 39406 |
FlyBaseID: | FBgn0052105 |
Length: | 640 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_000298.3 |
Gene: | POU3F4 / 5456 |
HGNCID: | 9217 |
Length: | 361 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 20/63 - (31%) |
Similarity: | 33/63 - (52%) |
Gaps: | 2/63 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 420 GRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKI 482
||: ::.||.:....:...:..|.:.|||..:...:||....|...||:|||.|:|.|.|::
Human 276 GRK--RKKRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRM 336
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3844 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.940 |
|
Return to query results.
Submit another query.