DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lmx1a and PITX3

DIOPT Version :9

Sequence 1:	NP_729801.1	Gene:	Lmx1a / 39406	FlyBaseID:	FBgn0052105	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_005020.1	Gene:	PITX3 / 5309	HGNCID:	9006	Length:	302	Species:	Homo sapiens

Alignment Length:	70	Identity:	28/70 - (40%)
Similarity:	44/70 - (62%)	Gaps:	2/70 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   417 PRDG--RRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKM 479
            |.||  ::..:|.||..||||.::.:|:|.::..|....||.:|..|.|:...|:|||:|:|||.
Human    53 PEDGSLKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKW 117

  Fly   480 KKIQR 484
            :|.:|
Human   118 RKRER 122

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lmx1a	NP_729801.1	LIM1_Lmx1b	275..327	CDD:188757
		LIM	333..388	CDD:295319
		Homeobox	427..480	CDD:278475	22/52 (42%)
PITX3	NP_005020.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..71		6/17 (35%)
		Homeobox	66..119	CDD:395001	22/52 (42%)
		OAR	258..275	CDD:397759
		OAR. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00138	262..275
		Nuclear localization signal. /evidence=ECO:0000255	268..272
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910