DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Lmo3

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006237647.1 Gene:Lmo3 / 497798 RGDID:1561357 Length:156 Species:Rattus norvegicus


Alignment Length:148 Identity:55/148 - (37%)
Similarity:76/148 - (51%) Gaps:22/148 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KCEKNFEL-------------CEGCGQKIHDRFLMNVGDANWHEQCL--ACCYCGM-QLHHTCYV 315
            |.||:|.:             |.||.:||.||:|:...|..|||.||  |||.|.: ::..|.|.
  Rat     3 KQEKSFGIQMLSVQPDTKPKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYT 67

  Fly   316 RNSKLYCKMDYDRLFGV--KCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFML 378
            :.:.:.|:.||.|||||  .|::|...|...|:|||...| |:||.||.|..|......|::|.|
  Rat    68 KANLILCRRDYLRLFGVTGNCAACSKLIPAFEMVMRAKDN-VYHLDCFACQLCNQRFCVGDKFFL 131

  Fly   379 RDGQLFC---YRHDLEKE 393
            ::..:.|   |...|.||
  Rat   132 KNNMILCQTDYEEGLMKE 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 22/54 (41%)
LIM 333..388 CDD:295319 20/57 (35%)
Homeobox 427..480 CDD:278475
Lmo3XP_006237647.1 LIM1_LMO1_LMO3 24..78 CDD:188774 21/53 (40%)
LIM2_LMO1_LMO3 88..142 CDD:188775 19/54 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.