DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and hbn

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_788420.1 Gene:hbn / 47894 FlyBaseID:FBgn0008636 Length:409 Species:Drosophila melanogaster


Alignment Length:416 Identity:88/416 - (21%)
Similarity:111/416 - (26%) Gaps:194/416 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PMPTNLNPVG--GSLYSLQQ---NHGGARFLDNPNPGSMTASSG------NSLHLSNSNNNLPTS 59
            |.|...:||.  .::||:.|   |....:..|.|:...:|....      :.||.||||      
  Fly    22 PAPVQESPVSRPRAVYSIDQILGNQHQIKRSDTPSEVLITHPHHGHPHHIHHLHSSNSN------ 80

  Fly    60 ISGNNSPTATASLTGQHQQH-QQQQHQQQQQHPHQQHQQHQQQHAASTTPVPINSCPTPTG---- 119
              |:|           |..| |||||.|||.|..||.||.|.|..|.....|.|   |..|    
  Fly    81 --GSN-----------HLSHQQQQQHSQQQHHSQQQQQQQQLQVQAKREDSPTN---TDGGLDVD 129

  Fly   120 HSPLSSSSSNSNHNNN------------------------------------------------- 135
            :....|||.|:.|:.:                                                 
  Fly   130 NDDELSSSLNNGHDLSDMERPRKVRRSRTTFTTFQLHQLERAFEKTQYPDVFTREDLAMRLDLSE 194

  Fly   136 ---------------------NNNNNG--------------------------GSSSNN------ 147
                                 |.:..|                          ||..:.      
  Fly   195 ARVQVWFQNRRAKWRKREKFMNQDKAGYLLPEQGLPEFPLGIPLPPHGLPGHPGSMQSEFWPPHF 259

  Fly   148 -LHSACNTLTAAAVAAASAAAVAAP--------SPAGTSVATSQLGGAVAAAIAAAAAAAAAA-- 201
             ||...|. .|||.|......:.||        :.....:..|.|.|...|..|||||||:|.  
  Fly   260 ALHQHFNP-AAAAAAGLLPQHLMAPHYKLPNFHTLLSQYMGLSNLNGIFGAGAAAAAAAASAGYP 323

  Fly   202 -----------------------------TTPTSTGPAATGSGNANGSGNGNGNGNGNGNGNGNG 237
                                         ..|..|.|.||.....||             |.|..
  Fly   324 QNLSLHAGLSAMSQVSPPCSNSSPRESPKLVPHPTPPHATPPAGGNG-------------GGGLL 375

  Fly   238 NGGGAATASAAAASKLSADCSGRTEV 263
            .||..:||:.:..|...|..:..|.|
  Fly   376 TGGLISTAAQSPNSAAGASSNASTPV 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475
hbnNP_788420.1 Homeobox 156..209 CDD:278475 0/52 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.