DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and hoxc8a

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001005771.1 Gene:hoxc8a / 449648 ZFINID:ZDB-GENE-990415-114 Length:250 Species:Danio rerio


Alignment Length:113 Identity:34/113 - (30%)
Similarity:52/113 - (46%) Gaps:16/113 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 LRP-----RDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQN 474
            :||     |:||:...|.:|:       :.:..|..:|...||.|..::....|:.|.|::||||
Zfish   142 MRPHAPGRRNGRQTYSRYQTL-------ELEKEFLFNPYLTRKRRIEVSHALSLTERQVKIWFQN 199

  Fly   475 QRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSAT----DDKDTNDKED 518
            :|.|.||...|.|..|..|.........||....    :||:|.:||:
Zfish   200 RRMKWKKENNKDKFPGQRGEAEAEAEEEGNEDGEAEEGEDKETEEKEE 247

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 15/52 (29%)
hoxc8aNP_001005771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..152 3/9 (33%)