DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and toy

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001368990.1 Gene:toy / 43833 FlyBaseID:FBgn0019650 Length:655 Species:Drosophila melanogaster


Alignment Length:244 Identity:69/244 - (28%)
Similarity:101/244 - (41%) Gaps:50/244 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 DEEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQN 474
            ||:..:|.| .:|..:|.||..:::|....:..|:::..|....||.||...||....:||||.|
  Fly   252 DEDSQMRLR-LKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSN 315

  Fly   475 QRAKMKKIQRKAKQNGGSGGGSGSGR--------GTGNSS--ATDDKDT--------NDKE---D 518
            :|||.::.::...|...:....||||        ||..||  ||.:..|        |..|   .
  Fly   316 RRAKWRREEKMRTQRRSADTVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSS 380

  Fly   519 KCVKQELGGDSSG--YLGG-LDSTFAS------QPLNPNLP--------FSPDDYP-ANSNDSFC 565
            ..|...|...|:|  .||| .::|..|      ||..|.||        :|....| |...:::.
  Fly   381 ALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAENYN 445

  Fly   566 SSDLSLDGSNFDQLDDDA----DSLSLNNLELQSTSSSGNQHSHSHSNP 610
            ||..|:..|...|.|...    |.|||.:..:.:      .|.::..||
  Fly   446 SSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA------HHRNTACNP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 19/52 (37%)
toyNP_001368990.1 PAX 29..153 CDD:128645
COG5576 <253..368 CDD:227863 36/115 (31%)
Homeobox 269..322 CDD:395001 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.