DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lmx1a and btn

DIOPT Version :9

Sequence 1:	NP_729801.1	Gene:	Lmx1a / 39406	FlyBaseID:	FBgn0052105	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_732768.1	Gene:	btn / 42664	FlyBaseID:	FBgn0014949	Length:	158	Species:	Drosophila melanogaster

Alignment Length:	68	Identity:	26/68 - (38%)
Similarity:	38/68 - (55%)	Gaps:	1/68 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   425 KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQN 489
            ::.||..:..|.||.:|.|..|....|..|..:|....|:.|.|:|||||:|.|.|:|:.: :|.
  Fly    87 RKERTAFSKTQLKQLEAEFCYSNYLTRLRRYEIAVALELTERQVKVWFQNRRMKCKRIKLE-EQQ 150

  Fly   490 GGS 492
            |.|
  Fly   151 GSS 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lmx1a	NP_729801.1	LIM1_Lmx1b	275..327	CDD:188757
		LIM	333..388	CDD:295319
		Homeobox	427..480	CDD:278475	21/52 (40%)
btn	NP_732768.1	Homeobox	90..142	CDD:278475	21/51 (41%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	45	1.000	Domainoid score	I3555
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.000