powered by:
Protein Alignment Lmx1a and bap
DIOPT Version :9
Sequence 1: | NP_729801.1 |
Gene: | Lmx1a / 39406 |
FlyBaseID: | FBgn0052105 |
Length: | 640 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_732637.1 |
Gene: | bap / 42537 |
FlyBaseID: | FBgn0004862 |
Length: | 382 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 22/73 - (30%) |
Similarity: | 31/73 - (42%) |
Gaps: | 0/73 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 411 EEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQ 475
|..|.....|....||.|...:..|..:.:..|.|........|..:||...|:...|::||||:
Fly 162 ESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYLSGPERSEMAKSLRLTETQVKIWFQNR 226
Fly 476 RAKMKKIQ 483
|.|.|:.|
Fly 227 RYKTKRKQ 234
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
45 |
1.000 |
Domainoid score |
I3555 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.