DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Ubx

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_536752.1 Gene:Ubx / 42034 FlyBaseID:FBgn0003944 Length:389 Species:Drosophila melanogaster


Alignment Length:444 Identity:87/444 - (19%)
Similarity:130/444 - (29%) Gaps:157/444 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 HPHQ----------QHQQHQQQHAASTTPVPINSCPTPTGHSPLSSSSSNSNHNNNNNNNNGGSS 144
            ||||          .|.|.....||:....|::...:|..:..|..::.:|.::           
  Fly    14 HPHQATGMAMGSGGHHDQTASAAAAAYRGFPLSLGMSPYANHHLQRTTQDSPYD----------- 67

  Fly   145 SNNLHSACNTLTAAAVAA-------ASAAAVAAPSPAGTSVATSQLGGAVAAAIAAAAAAAAAAT 202
             .::.:|||.:......|       ..|.||........:..::..||.                
  Fly    68 -ASITAACNKIYGDGAGAYKQDCLNIKADAVNGYKDIWNTGGSNGGGGG---------------- 115

  Fly   203 TPTSTGPAATGSGNANGSGNGNGNGNGNGNGNGNGNGGGAATASAAAA-SKLSA--DCSGRTEVG 264
               ..|....|:|...|:||.||....|.||..|..||.....||... |::..  |.||.:.|.
  Fly   116 ---GGGGGGGGAGGTGGAGNANGGNAANANGQNNPAGGMPVRPSACTPDSRVGGYLDTSGGSPVS 177

  Fly   265 HI--KCEKNFELCEGCGQKIHDRFLMNVGDAN--WHEQC-----LACCYCGMQLH----HTCY-- 314
            |.  ....|..:..|.|.....:..:.|..|.  |:..|     .|.......||    ||.|  
  Fly   178 HRGGSAGGNVSVSGGNGNAGGVQSGVGVAGAGTAWNANCTISGAAAQTAAASSLHQASNHTFYPW 242

  Fly   315 ----------VRNSKLYCKMDYDRLFGVK-------CSSCCHAILPQELVMRPIPNFVFHLPCFV 362
                      ...||:  :.|..:..|:.       ..|...::||..|                
  Fly   243 MAIAGECPEDPTKSKI--RSDLTQYGGISTDMGKRYSESLAGSLLPDWL---------------- 289

  Fly   363 CYACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRP 427
                                                      |..||          .|||    
  Fly   290 ------------------------------------------GTNGL----------RRRG---- 298

  Fly   428 RTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKK 481
            |...|..|..:.:..|..:....|:.|..:|....|:.|.:::||||:|.|:||
  Fly   299 RQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQIKIWFQNRRMKLKK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 15/74 (20%)
LIM 333..388 CDD:295319 4/61 (7%)
Homeobox 427..480 CDD:278475 15/52 (29%)
UbxNP_536752.1 Homeobox 299..352 CDD:395001 15/52 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.