DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Unc-115b

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_731390.1 Gene:Unc-115b / 41178 FlyBaseID:FBgn0260463 Length:784 Species:Drosophila melanogaster


Alignment Length:397 Identity:89/397 - (22%)
Similarity:140/397 - (35%) Gaps:85/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 RTEVGHIKCEKNFELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQL-HHTCYVRNSKLYCK 323
            |||:|.....|....|..|.:|.... ::.|.|.::|:.|..||.|...| ....:.:::..||.
  Fly    31 RTELGKTGQGKQKIYCAKCTKKCSGE-VLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCI 94

  Fly   324 MDYDRLFGVKCSSCCHAILPQELVMRPIPNFV---FHLPCFVCYACRLPLQKGEQFMLRDGQLFC 385
            .||.||:|.||::|      |:.|...:.:.:   :|..||.|..|:.|.:.|.:......::.|
  Fly    95 PDYQRLYGTKCANC------QQYVEGEVVSTMGKTYHQKCFTCSKCKQPFKSGSKVTNTGKEVLC 153

  Fly   386 YRHDLEKEMFLAAA----AAQHCGFVGLDEEDLLRPRDGRRGPKRPR---TILTSQQRK----QF 439
                   |..:..|    :.|..|             .|...|..|.   |..|:.|:.    ..
  Fly   154 -------EQCVTGAPVSPSRQATG-------------GGVSSPAPPAESPTRATAHQQHGSVISH 198

  Fly   440 KASF--DQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSG--- 499
            ||..  |..|..|....|.|.:...| |.:.:.|      .:...:.||.|...:|...|..   
  Fly   199 KAHLKEDYDPNDCAGCGELLKEGQAL-VALDRQW------HVSCFRCKACQAVLNGEYMGKDAVP 256

  Fly   500 -------RGTGNSSATDDK----------DTNDKEDKCVKQELGGDSSG-----YLGGLDSTFAS 542
                   :|.|...|...:          |.:.....|.:....||..|     ||.|      |
  Fly   257 YCEKCYQKGFGVKCAYCSRFISGKVLQAGDNHHFHPTCARCTKCGDPFGDGEEMYLQG------S 315

  Fly   543 QPLNPNLPFSPDDYPANSNDSFCSSDLSLDGSNFDQLDDDADSLS---LNNLELQSTSSSGNQHS 604
            ...:|.....|.:.....|....:|.:....||.:..|.:.|.:|   |:.:.::|.:.|.|...
  Fly   316 AIWHPRCGPGPSESGIILNGGGGTSSVVGGASNGNFTDTECDRMSSSALSEMYIRSRTPSFNGSL 380

  Fly   605 HSHSNPH 611
            :|.|..|
  Fly   381 YSSSRKH 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 14/52 (27%)
LIM 333..388 CDD:295319 13/57 (23%)
Homeobox 427..480 CDD:278475 14/61 (23%)
Unc-115bNP_731390.1 LIM1_abLIM 46..97 CDD:188713 13/51 (25%)
LIM2_abLIM 102..157 CDD:188714 15/67 (22%)
LIM3_abLIM 211..262 CDD:188715 11/57 (19%)
LIM4_abLIM 270..326 CDD:188716 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.