DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and zen2

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_476794.1 Gene:zen2 / 40827 FlyBaseID:FBgn0004054 Length:252 Species:Drosophila melanogaster


Alignment Length:204 Identity:50/204 - (24%)
Similarity:76/204 - (37%) Gaps:47/204 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQN 489
            ||.||..:|.|..:.:..|..:....|..|..:::...|:.|.|::||||:|.|:||   ...:.
  Fly    44 KRSRTAFSSLQLIELEREFHLNKYLARTRRIEISQRLALTERQVKIWFQNRRMKLKK---STNRK 105

  Fly   490 GGSGGGSGSGRGTGNSSATDDKD-----------TNDKEDKCVKQELGG-----------DSSGY 532
            |..|..:.|...:..||....||           ..:.|...::|...|           .|..|
  Fly   106 GAIGALTTSIPLSSQSSEDLQKDDQIVERLLRYANTNVETAPLRQVDHGVLEEGQITPPYQSYDY 170

  Fly   533 L---------------GGLDSTFASQ--PLNPNLPFSPDDYPANSND-----SFCSSDLSLDGSN 575
            |               ...|:.:||.  .|.|.:|.:.:....|:.|     :||....|...|:
  Fly   171 LHEFSPEPMALPQLPFNEFDANWASSWLGLEPTIPIAENVIEHNTQDQPMIQNFCWDSNSSSASS 235

  Fly   576 FDQLDDDAD 584
            .|.||.|.|
  Fly   236 SDILDVDYD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 16/52 (31%)
zen2NP_476794.1 Homeobox 46..99 CDD:278475 16/52 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.