DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and lab

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_476613.1 Gene:lab / 40817 FlyBaseID:FBgn0002522 Length:629 Species:Drosophila melanogaster


Alignment Length:300 Identity:77/300 - (25%)
Similarity:104/300 - (34%) Gaps:96/300 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QQNHGGARFLDNPNPGSMTASSGNSL---HLSNSNNNLPTSISGNNSPTATASLTGQHQQHQQQQ 83
            ||:..|:..||..:...|.|...:.|   ||.|..||                   .||  ||.|
  Fly   268 QQHLAGSYALDAMDSLGMHAHMHHGLPHGHLGNLANN-------------------PHQ--QQPQ 311

  Fly    84 HQQQQQHPHQQHQQHQQQHAASTTPVPINSCPTPTGHSPLSSSSSNSNHNNNNNNNNG----GSS 144
            .|||||.||||.|..|.|              :|..|.....:|.:.|...|.....|    |||
  Fly   312 VQQQQQQPHQQPQHPQNQ--------------SPAAHQQHHQNSVSPNGGMNRQQRGGVISPGSS 362

  Fly   145 SNNLHSACNTLTAAAVAAASAAAVAAPSPAGTS-------------VATSQLGGAVAAAIAAAAA 196
            :::..||.|        .|..|:..:.||..:|             |...|.....|:.||:...
  Fly   363 TSSSTSASN--------GAHPASTQSKSPNHSSSIPTYKWMQLKRNVPKPQAPKLPASGIASMHD 419

  Fly   197 AAAAATTPTSTGPAATGSGNANG----SGNGN----------------------GNGNGNGNGNG 235
            ...........|....|||..||    .|||:                      |:.:.||.|.|
  Fly   420 YQMNGQLDMCRGGGGGGSGVGNGPVGVGGNGSPGIGGVLSVQNSLIMANSAAAAGSAHPNGMGVG 484

  Fly   236 NGNGGGAATASAAAASKLSADCSGRTEVGH---IKCEKNF 272
            .|:|.|.::.|.::    :.:.||||...:   .:.||.|
  Fly   485 LGSGSGLSSCSLSS----NTNNSGRTNFTNKQLTELEKEF 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475
labNP_476613.1 Homeobox 505..557 CDD:278475 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.