DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and ABLIM1

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006717900.1 Gene:ABLIM1 / 3983 HGNCID:78 Length:788 Species:Homo sapiens


Alignment Length:399 Identity:83/399 - (20%)
Similarity:125/399 - (31%) Gaps:127/399 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 CEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHHTCYVRNSKLYCKMDYDRLFGVKCSSCCH 339
            |.|||:.|.:...:...|..||..|..|..||..|......::...||:.||..||||||.: ||
Human   166 CAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEA-CH 229

  Fly   340 AILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQH- 403
            ..:..:::.....:  :|..|..|..|.....:||                  ||:|..:...| 
Human   230 QFITGKVLEAGDKH--YHPSCARCSRCNQMFTEGE------------------EMYLQGSTVWHP 274

  Fly   404 -CGFVGLDEEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRV 467
             |......||.|..|...|.                 .:.|..|        ::|.:.||.|..:
Human   275 DCKQSTKTEEKLRLPNIRRS-----------------SSDFFYS--------KSLIRRTGRSPSL 314

  Fly   468 VQVWFQNQRAKMKKI-QRKAKQNGGSGGGSGSGRGTGNSSATDDKD------------------- 512
                 |..|...:.| .|......||.|.:...:  .::...|.||                   
Human   315 -----QPTRTSSESIYSRPGSSIPGSPGHTIYAK--VDNEILDYKDLAAIPKVKAIYDIERPDLI 372

  Fly   513 ------TNDKEDKCVKQELG---------GDSSGY-------------LGGLDSTFASQPLNPNL 549
                  |:..:||..:|.||         ..:.||             .|.::|     |:....
Human   373 TYEPFYTSGYDDKQERQSLGESPRTLSPTPSAEGYQDVRDRMIHRSTSQGSINS-----PVYSRH 432

  Fly   550 PFSPDDYPANSNDSFCSSDLSLDGSNFDQLDDDADSLSLNNLELQSTSSSGNQHSHSHSNP---H 611
            .::|.  .:.|...|...:|...|              :..|....|||....||.|..||   |
Human   433 SYTPT--TSRSPQHFHRPELLSPG--------------VQRLSYLRTSSLSPTHSDSRPNPPFRH 481

  Fly   612 DMLANLNNS 620
            ..:.::..:
Human   482 HFIPHIKGN 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 16/51 (31%)
LIM 333..388 CDD:295319 10/54 (19%)
Homeobox 427..480 CDD:278475 8/52 (15%)
ABLIM1XP_006717900.1 LIM1_abLIM 39..90 CDD:188713
LIM2_abLIM 95..150 CDD:188714
LIM3_abLIM 166..217 CDD:188715 15/50 (30%)
LIM4_abLIM 225..280 CDD:188716 14/75 (19%)
AbLIM_anchor 318..752 CDD:292800 35/196 (18%)
VHP 753..788 CDD:128458
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.