powered by:
Protein Alignment Lmx1a and CG34031
DIOPT Version :9
Sequence 1: | NP_729801.1 |
Gene: | Lmx1a / 39406 |
FlyBaseID: | FBgn0052105 |
Length: | 640 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001246894.1 |
Gene: | CG34031 / 3885665 |
FlyBaseID: | FBgn0054031 |
Length: | 219 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 22/71 - (30%) |
Similarity: | 34/71 - (47%) |
Gaps: | 3/71 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 411 EEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQ 475
:|..||.|...| :||...::.|.::.:..|:.........|..|:|...|:...|:.||||:
Fly 123 QEKQLRKRFTDR---KPRQAYSASQLERLENEFNLDKYLSVSKRVELSKSLSLTEVQVKTWFQNR 184
Fly 476 RAKMKK 481
|.|.||
Fly 185 RTKWKK 190
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
45 |
1.000 |
Domainoid score |
I3555 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.