DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and gsb-n

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_523862.1 Gene:gsb-n / 38004 FlyBaseID:FBgn0001147 Length:449 Species:Drosophila melanogaster


Alignment Length:267 Identity:65/267 - (24%)
Similarity:98/267 - (36%) Gaps:92/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 RRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRK 485
            :|..:|.||..|::|.:..:.:|.::..|....||.||:.|.|:...:||||.|:||:::     
  Fly   179 KRKQRRSRTTFTAEQLEALERAFSRTQYPDVYTREELAQTTALTEARIQVWFSNRRARLR----- 238

  Fly   486 AKQNGGSGGG-----SGS---GRGTGNSSATDDKDTNDKEDKCVKQELG------GDSSGY---- 532
             |.:|||..|     |||   |.|.|.|.||              ..||      |..:||    
  Fly   239 -KHSGGSNSGLSPMNSGSSNVGVGVGLSGAT--------------APLGYGPLGVGSMAGYSPAP 288

  Fly   533 --------------------------------------LGGLDST-FASQPLNPNLPFSPDDYPA 558
                                                  :||.|.. .|:|...|.....|..:.:
  Fly   289 GTTATGAGMNDGVHHAAHAPSSHHSAATAAAAAHHHTQMGGYDLVQSAAQHGFPGGFAQPGHFGS 353

  Fly   559 NSNDSFCSSDLSLDGSNFDQLDDDADSLS-----------LNNLELQSTSSSGNQHSHSHSNPHD 612
            .:......|.|::|  :|.:|  .|||:|           .:.||..|..|....|:.::.|.|.
  Fly   354 QNYYHQDYSKLTID--DFSKL--TADSVSKISPSLHLSDNYSKLEAPSNWSQAAYHAAANYNAHV 414

  Fly   613 MLANLNN 619
            ....||:
  Fly   415 AQHQLND 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 19/52 (37%)
gsb-nNP_523862.1 PAX 20..141 CDD:278709
Homeobox 185..238 CDD:278475 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.