DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Lmo4

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001009708.1 Gene:Lmo4 / 362051 RGDID:1305670 Length:165 Species:Rattus norvegicus


Alignment Length:157 Identity:60/157 - (38%)
Similarity:78/157 - (49%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 NGGGAATASAAAASKLSADCSGRTEVGHIKCEKNFELCEGCGQKIHDRFLMNVGDANWHEQCLAC 302
            |.|.::......|..||                 ::.|.|||.||.||||:...|:.||.:||.|
  Rat     3 NPGSSSQPPPVTAGSLS-----------------WKRCAGCGGKIADRFLLYAMDSYWHSRCLKC 50

  Fly   303 CYCGMQLHH---TCYVRNSKLYCKMDYDRLFGVK--CSSCCHAILPQELVMRPIPNFVFHLPCFV 362
            ..|..||..   :||.::..:.|:.||.||||..  ||:|..:|...|||||...| |:||.||.
  Rat    51 SCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGN-VYHLKCFT 114

  Fly   363 CYACRLPLQKGEQFMLRDGQLFCYRHD 389
            |..||..|..|::|...:|.||| .||
  Rat   115 CSTCRNRLVPGDRFHYINGSLFC-EHD 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 23/54 (43%)
LIM 333..388 CDD:295319 25/56 (45%)
Homeobox 427..480 CDD:278475
Lmo4NP_001009708.1 LIM1_LMO4 23..77 CDD:188772 22/53 (42%)
LIM2_LMO4 87..141 CDD:188773 27/56 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.