DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and CG31624

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster


Alignment Length:123 Identity:39/123 - (31%)
Similarity:55/123 - (44%) Gaps:13/123 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 DCSGRTEVGHIKCEKNF-----ELCEGCGQKIHDRFLMNVGDANWHEQCLACC--YCGMQL-HHT 312
            |.:...:.|...|.|.|     ..|.||.:.|.::.:..:|: .|||.|. ||  .|...| ..|
  Fly    42 DATFNVQSGEPVCNKCFVERYTYTCAGCKKPILEKTICAMGE-RWHEACF-CCGGACKKPLASQT 104

  Fly   313 CYVRNSKLYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPL 370
            .|.|:.|.|||.||:.||..:|:.|...|....::..   |..:|..||.|..|..|:
  Fly   105 FYERDGKPYCKQDYENLFAARCAKCEKPITDSAVLAM---NVKWHRNCFQCNKCENPI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 21/54 (39%)
LIM 333..388 CDD:295319 10/38 (26%)
Homeobox 427..480 CDD:278475
CG31624NP_001163031.1 LIM 7..58 CDD:351770 4/15 (27%)
LIM 66..118 CDD:351770 20/53 (38%)
LIM 125..176 CDD:214528 10/38 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.