DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and prd

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:260 Identity:56/260 - (21%)
Similarity:94/260 - (36%) Gaps:72/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 RRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRK 485
            :|..:|.||..::.|..:.:.:|:::..|....||.||:.|.|:...:||||.|:||:::| |..
  Fly   210 KRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRK-QHT 273

  Fly   486 AKQNGGSGGGSGSGRGTGNSSATD-------------------DKDTNDKEDKCVKQELGGDSSG 531
            :...|..||.:.|......||:..                   |..|..::    :.:..|..:.
  Fly   274 SVSGGAPGGAAASVSHVAASSSLPSVVSSVPSMAPLAMMPGSLDPATVYQQ----QYDFYGSHAN 334

  Fly   532 YLGGLDSTFASQPLNPNLPFSPDDYPANSNDSFCSSDLSLDGSN--------------------- 575
            ......:..||..|:|.:..:|..:....|.|..::...:.|.|                     
  Fly   335 ISVSAAAPMASSNLSPGITTTPPHHHQFYNPSANTASYIMPGENGNTTPTGNIIVSSYETQLGSV 399

  Fly   576 ------------------------FDQLDDDADSLSLNNLELQSTSSSGNQHSHSHSNPHDMLAN 616
                                    |.||....:|||........|||||   ::|.::|...|||
  Fly   400 YGTETETHQTMPRNESPNESVSSAFGQLPPTPNSLSAVVSGAGVTSSSG---ANSGADPSQSLAN 461

  Fly   617  616
              Fly   462  461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 18/52 (35%)
prdNP_723721.1 PAX 27..154 CDD:238076
Homeobox 217..269 CDD:278475 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.