DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and CG5708

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001285799.1 Gene:CG5708 / 34361 FlyBaseID:FBgn0032196 Length:241 Species:Drosophila melanogaster


Alignment Length:208 Identity:65/208 - (31%)
Similarity:87/208 - (41%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 NGNGNGGGAATASAAAASKLSADCSGRTEVGH---IKCEKNFELCEGCGQKIHDRFLMNVGDANW 295
            |.|.......|.|..::|:||.......:..:   |......::|.|||.||.||:|:...|..|
  Fly    34 NSNHTKDTVETNSNISSSQLSFMDESSNDFNNQQLIHSNSLIKVCGGCGDKISDRYLLYALDRYW 98

  Fly   296 HEQCLACCYCGMQLHH---TCYVRNSKLYCKMDYDRLFGVK--CSSCCHAILPQELV-------- 347
            |..||.|..||..|..   :|:.|...:.||.||..:||..  ||.|...|.|.|||        
  Fly    99 HNGCLKCHCCGAMLAEVGSSCFTRRGLILCKKDYSSMFGCSGVCSGCGETIPPSELVAKALTGIN 163

  Fly   348 -------MRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCG 405
                   .:.|.|.||||.||.|..|...|:.|:::.:....|.| ..|..|   |....|...|
  Fly   164 NIDLQNQQKQIINCVFHLRCFSCAKCGSSLRPGDRYTMLGASLVC-EQDWHK---LLKGPANSNG 224

  Fly   406 FVGLDEEDLLRPR 418
            .:|..:..:.|||
  Fly   225 TLGQRKGKVGRPR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 23/54 (43%)
LIM 333..388 CDD:295319 22/71 (31%)
Homeobox 427..480 CDD:278475
CG5708NP_001285799.1 LIM1_LMO4 78..132 CDD:188772 22/53 (42%)
LIM 142..212 CDD:413332 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.