DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and AgaP_AGAP007839

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_555680.3 Gene:AgaP_AGAP007839 / 3291599 VectorBaseID:AGAP007839 Length:141 Species:Anopheles gambiae


Alignment Length:153 Identity:48/153 - (31%)
Similarity:58/153 - (37%) Gaps:52/153 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 TPTSTG--PAATGSGNANGSGNGNGNGNGNGNGNG------------------NGNGGGAATASA 247
            :|.:.|  |..|...|.:|.|.|.|.|.|.|.|.|                  :|||||      
Mosquito    18 SPDNAGSYPQLTPHHNGHGGGGGGGGGGGGGGGGGPNSMVSQMDGQQGFHQMNSGNGGG------ 76

  Fly   248 AAASKLSADCSGRTEVGHIKCEKNFELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQL--- 309
                          .|.|         |.|||.||.:||.::..|..||..||.|..||..|   
Mosquito    77 --------------PVKH---------CAGCGGKITERFFLHALDRYWHNSCLKCSCCGAMLADI 118

  Fly   310 HHTCYVRNSKLYCKMDYDRLFGV 332
            ..:||.|:..:.||.||.||..|
Mosquito   119 GSSCYTRSGMILCKADYSRLVAV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 23/54 (43%)
LIM 333..388 CDD:295319 48/153 (31%)
Homeobox 427..480 CDD:278475
AgaP_AGAP007839XP_555680.3 LIM1_LMO4 81..135 CDD:188772 22/53 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.