DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and HOXD3

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_008829.3 Gene:HOXD3 / 3232 HGNCID:5137 Length:432 Species:Homo sapiens


Alignment Length:268 Identity:71/268 - (26%)
Similarity:98/268 - (36%) Gaps:83/268 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 CGFVGLDEEDLLRPRDGRRGP--KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVR 466
            |...|...||...|     ||  ||.||..||.|..:.:..|..:...||..|..:|....|:.|
Human   177 CATAGESCEDKSPP-----GPASKRVRTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTER 236

  Fly   467 VVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSS- 530
            .:::||||:|.|.||.| |||             |..:|.|:...:.:        ..|||.:. 
Human   237 QIKIWFQNRRMKYKKDQ-KAK-------------GILHSPASQSPERS--------PPLGGAAGH 279

  Fly   531 -GYLGGL------------DSTFA------------SQPLNPNLP---------FSPDDYPANSN 561
             .|.|.|            ...||            :.||:..||         |.|  :|..||
Human   280 VAYSGQLPPVPGLAYDAPSPPAFAKSQPNMYGLAAYTAPLSSCLPQQKRYAAPEFEP--HPMASN 342

  Fly   562 -DSFCSSDLS----LDGSNFDQLDDDADS--LSLNNLELQSTSS---------SGNQHSHSHSNP 610
             ..|.|::|.    ..|.||.:....|..  .:|.:|...|::|         .||.| |...:|
Human   343 GGGFASANLQGSPVYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHH-HGPCDP 406

  Fly   611 HDMLANLN 618
            |....:|:
Human   407 HPTYTDLS 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 18/52 (35%)
HOXD3NP_008829.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..62
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 68..197 8/24 (33%)
Antp-type hexapeptide 160..165
Homeobox 198..250 CDD:306543 18/51 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 253..280 10/48 (21%)
DUF4074 369..430 CDD:315871 12/47 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 400..432 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.