Sequence 1: | NP_729801.1 | Gene: | Lmx1a / 39406 | FlyBaseID: | FBgn0052105 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_008829.3 | Gene: | HOXD3 / 3232 | HGNCID: | 5137 | Length: | 432 | Species: | Homo sapiens |
Alignment Length: | 268 | Identity: | 71/268 - (26%) |
---|---|---|---|
Similarity: | 98/268 - (36%) | Gaps: | 83/268 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 404 CGFVGLDEEDLLRPRDGRRGP--KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVR 466
Fly 467 VVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSS- 530
Fly 531 -GYLGGL------------DSTFA------------SQPLNPNLP---------FSPDDYPANSN 561
Fly 562 -DSFCSSDLS----LDGSNFDQLDDDADS--LSLNNLELQSTSS---------SGNQHSHSHSNP 610
Fly 611 HDMLANLN 618 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lmx1a | NP_729801.1 | LIM1_Lmx1b | 275..327 | CDD:188757 | |
LIM | 333..388 | CDD:295319 | |||
Homeobox | 427..480 | CDD:278475 | 18/52 (35%) | ||
HOXD3 | NP_008829.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 43..62 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 68..197 | 8/24 (33%) | |||
Antp-type hexapeptide | 160..165 | ||||
Homeobox | 198..250 | CDD:306543 | 18/51 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 253..280 | 10/48 (21%) | |||
DUF4074 | 369..430 | CDD:315871 | 12/47 (26%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 400..432 | 5/16 (31%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |