DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and HOXC13

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_059106.2 Gene:HOXC13 / 3229 HGNCID:5125 Length:330 Species:Homo sapiens


Alignment Length:352 Identity:71/352 - (20%)
Similarity:107/352 - (30%) Gaps:130/352 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 NANGSGNGNGNGNGNGNGNGNGNG-GGAATASAAAASKLSADCSGRTEVGHIKCEKNFELCEGCG 279
            :|..||.|.|.|.|.|...|.|.| .||:...|.:...|.:.|...                   
Human    22 SAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPAS------------------- 67

  Fly   280 QKIHDRFLM---------------------NVGDANWHEQC-------------------LACCY 304
               |.|.|:                     ::.......||                   ....|
Human    68 ---HCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSY 129

  Fly   305 CGMQLHHTCYVRNSKLYCKMDYDRLFGVKCSSCCH----------AILPQELVMRPIPNFVFHLP 359
            .|.:|.|     |..|..|            .|.:          ..||.:.:......|.|: |
Human   130 YGCRLSH-----NVNLQQK------------PCAYHPGDKYPEPSGALPGDDLSSRAKEFAFY-P 176

  Fly   360 CFVC------------------------YACRLPLQKGEQFMLRDG---QLFCYRHDLEKEMFLA 397
            .|..                        :...:|::..:.:.|.:|   |::|     .||...:
Human   177 SFASSYQAMPGYLDVSVVPGISGHPEPRHDALIPVEGYQHWALSNGWDSQVYC-----SKEQSQS 236

  Fly   398 AAAAQHCGFVGLDEEDLLRPR--DGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKD 460
            |    |.......:...|:|.  ..|||.|: |...|..|.|:.:..:..|....::.|..::..
Human   237 A----HLWKSPFPDVVPLQPEVSSYRRGRKK-RVPYTKVQLKELEKEYAASKFITKEKRRRISAT 296

  Fly   461 TGLSVRVVQVWFQNQRAKMKKIQRKAK 487
            |.||.|.|.:||||:|.|.||:..|:|
Human   297 TNLSERQVTIWFQNRRVKEKKVVSKSK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 12/91 (13%)
LIM 333..388 CDD:295319 12/91 (13%)
Homeobox 427..480 CDD:278475 17/52 (33%)
HOXC13NP_059106.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..50 8/19 (42%)
HoxA13_N 54..166 CDD:315049 18/150 (12%)
HOX 260..312 CDD:197696 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.