DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Lim1

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_572505.1 Gene:Lim1 / 31813 FlyBaseID:FBgn0026411 Length:505 Species:Drosophila melanogaster


Alignment Length:331 Identity:109/331 - (32%)
Similarity:147/331 - (44%) Gaps:108/331 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 GRTE----VGHIKCEKNFELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHHTCYVRNSK 319
            ||:|    ||        :.|.||.:.|.|:||:||.:..||..|:.||.|...|...|:.|.||
  Fly    15 GRSEPPVGVG--------DPCAGCNKPILDKFLLNVLERAWHASCVRCCECLQPLTDKCFSRESK 71

  Fly   320 LYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQ-FMLRDGQL 383
            |||:.|:.|.:|.|||.|...|.|.:||.:| .:.||||.||.|..||..|..||| ::|.|.:.
  Fly    72 LYCRNDFFRRYGTKCSGCGQGIAPSDLVRKP-RDKVFHLNCFTCCICRKQLSTGEQLYVLDDNKF 135

  Fly   384 FCYRHDLEKEMFLAAAAAQHCGFVGL------------DEED------------LLRPR------ 418
            .|      |:.:|...|.. ||...|            |::|            :|.|.      
  Fly   136 IC------KDDYLLGKAPS-CGHNSLSDSLMGSASEDDDDDDPPHLRATALGLGVLGPNGPDSAG 193

  Fly   419 ---------------------------------DGR-------------RGPKR--PRTILTSQQ 435
                                             |||             .|.||  |||.:.::|
  Fly   194 GPLGTSDISVQSMSTDSKNTHDDSDQGSLDGDPDGRGDSQAENKSPDDANGSKRRGPRTTIKAKQ 258

  Fly   436 RKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSG-----GG 495
            .:..|.:|:|:|||.|.:||.|||:|||.:||:||||||:|:|    :|:.||....|     ||
  Fly   259 LEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSK----ERRMKQITSMGRPPFFGG 319

  Fly   496 SGSGRG 501
            :...||
  Fly   320 ARKMRG 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 24/51 (47%)
LIM 333..388 CDD:295319 25/55 (45%)
Homeobox 427..480 CDD:278475 29/52 (56%)
Lim1NP_572505.1 LIM1_Lhx1_Lhx5 27..78 CDD:188753 23/50 (46%)
LIM2_Lhx1_Lhx5 86..141 CDD:188761 25/61 (41%)
COG5576 185..324 CDD:227863 42/142 (30%)
Homeobox 250..303 CDD:278475 29/56 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444993
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.