Sequence 1: | NP_729801.1 | Gene: | Lmx1a / 39406 | FlyBaseID: | FBgn0052105 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_068777.1 | Gene: | HLX / 3142 | HGNCID: | 4978 | Length: | 488 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 44/205 - (21%) |
---|---|---|---|
Similarity: | 75/205 - (36%) | Gaps: | 58/205 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 417 PRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAK--- 478
Fly 479 MKKIQRK--------AKQNGGSGGGSGS--------GRGTGNSSATD---------DKDTNDKED 518
Fly 519 KCVKQEL------------------GGDSSGYLGGLDSTFASQPLNPNLPFSPDDYPANSNDSFC 565
Fly 566 SSDLSLDGSN 575 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lmx1a | NP_729801.1 | LIM1_Lmx1b | 275..327 | CDD:188757 | |
LIM | 333..388 | CDD:295319 | |||
Homeobox | 427..480 | CDD:278475 | 18/55 (33%) | ||
HLX | NP_068777.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 118..173 | ||
Abdominal-A | 227..>344 | CDD:332641 | 22/74 (30%) | ||
Homeobox | 279..332 | CDD:306543 | 18/52 (35%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 331..488 | 24/143 (17%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |