DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Lhx6

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001101307.2 Gene:Lhx6 / 311901 RGDID:1306174 Length:392 Species:Rattus norvegicus


Alignment Length:321 Identity:103/321 - (32%)
Similarity:149/321 - (46%) Gaps:31/321 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 AAPS-PAGTSVATSQLGGAVAAAIAAAAAAAAAATTP--TSTGPAATGSGNANGSGNGNGNGNGN 230
            |||: |.|..:...  ||.....:.|...:...|||.  ..|.|.|....:|...........|.
  Rat     8 AAPALPEGCRLPAE--GGPTTDQVMAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGR 70

  Fly   231 GNGNGNGNGGGAATASAAAASKLSADCSGRTEVGHIKCEKNFELCEGCGQKIHDRFLMNVGDANW 295
            .:..........:..|||:    |...:|:            .:|..||.:|.||:|:.|.:..|
  Rat    71 ASPCTPSTPSVCSPPSAAS----SVPSAGK------------NICSSCGLEILDRYLLKVNNLIW 119

  Fly   296 HEQCLACCYC--GMQLHHTCYVRNSKLYCKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHL 358
            |.:||.|..|  .::..::||::|.::||||||...||.||:.|...|...:.|.|...| .:||
  Rat   120 HVRCLECSVCRTSLRQQNSCYIKNKEIYCKMDYFSRFGTKCARCGRQIYASDWVRRARGN-AYHL 183

  Fly   359 PCFVCYACRLPLQKGEQFMLRDGQLFCYRH-DLEKEMFLAAAAAQHCGFVGLDEEDLL-RPRDGR 421
            .||.|::|:..|..||:|.|.:.::.|..| |...|....||...:    ||..|..: ..:|.:
  Rat   184 ACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLKRAAENGN----GLTLEGAVPSEQDSQ 244

  Fly   422 RGP-KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKK 481
            ..| ||.||..|::|.:..:|.|.|...|..:..:.||..||||.||:||||||.||:.||
  Rat   245 PKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 22/53 (42%)
LIM 333..388 CDD:295319 19/54 (35%)
Homeobox 427..480 CDD:278475 24/52 (46%)
Lhx6NP_001101307.2 LIM1_Lhx6 99..152 CDD:188766 21/52 (40%)
LIM2_Lhx6 160..214 CDD:188768 18/54 (33%)
Homeobox 252..305 CDD:395001 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.