DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Zfhx4

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006232224.1 Gene:Zfhx4 / 310250 RGDID:1563022 Length:3619 Species:Rattus norvegicus


Alignment Length:251 Identity:61/251 - (24%)
Similarity:94/251 - (37%) Gaps:60/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 DEED--LLRPRDGRRG-----PKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRV 467
            |:||  ......|..|     .||.||.:|.:|.:.....:.....|.||:.:.:|::.||..||
  Rat  2586 DKEDNNCSEKEGGNSGEDQHRDKRLRTTITPEQLEILYEKYLLDSNPTRKMLDHIAREVGLKKRV 2650

  Fly   468 VQVWFQNQRAKMKKIQRKAKQNGGS--------------------------GGGSGSGRGTGNSS 506
            |||||||.||:.:|.|.:|.....|                          ..|..:|.....|.
  Rat  2651 VQVWFQNTRARERKGQFRAVGPAQSHKRCPFCRALFKAKSALESHIRSRHWNEGKQAGYSLPPSP 2715

  Fly   507 ATDDKDTNDKEDKCV----------KQELGGDSSGYLGGLDSTFASQ--PLNPNLPFSPDDYPAN 559
            ....:|..:...|.:          |.:|..::.  |....||..|:  .|:|....||..:.|.
  Rat  2716 LISTEDGGESPQKYIYFDYPSLPLTKIDLSSENE--LASTVSTPVSKTAELSPKNLLSPSSFKAE 2778

  Fly   560 SNDSFCSSDL------SLDGSNFDQLDDDADSLSLNNLELQSTSSSGNQHSHSHSN 609
                 |..|:      |.| :.:||...|.|..|..|..: |.:::|::.:....|
  Rat  2779 -----CPEDVENLNAPSAD-AGYDQNKTDFDETSSINTAI-SDATTGDEGAADMEN 2827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 21/52 (40%)
Zfhx4XP_006232224.1 C2H2 Zn finger 620..641 CDD:275368
C2H2 Zn finger 651..672 CDD:275368
C2H2 Zn finger 706..723 CDD:275368
C2H2 Zn finger 1404..1424 CDD:275371
C2H2 Zn finger 1432..1449 CDD:275371
SFP1 <1489..1616 CDD:227516
C2H2 Zn finger 1548..1572 CDD:275368
C2H2 Zn finger 1600..1618 CDD:275368
COG5576 2106..2245 CDD:227863
HOX 2135..2190 CDD:197696
Homeobox 2234..2288 CDD:395001
PspC_subgroup_1 <2398..>2476 CDD:411407
COG5576 2544..>2666 CDD:227863 29/79 (37%)
Homeobox 2611..2664 CDD:395001 21/52 (40%)
Homeobox 2934..2987 CDD:395001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.