DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lmx1a and VSX1

DIOPT Version :9

Sequence 1:	NP_729801.1	Gene:	Lmx1a / 39406	FlyBaseID:	FBgn0052105	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_055403.2	Gene:	VSX1 / 30813	HGNCID:	12723	Length:	365	Species:	Homo sapiens

Alignment Length:	84	Identity:	33/84 - (39%)
Similarity:	48/84 - (57%)	Gaps:	4/84 - (4%)

- Green bases have known domain annotations that are detailed below.

  Fly   410 DEEDL-LRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQ 473
            |..|| ..|..|:|..:|.||:.|:.|.::.:.:|.::..|....||.||..|.|....:|||||
Human   149 DRNDLKASPTLGKRKKRRHRTVFTAHQLEELEKAFSEAHYPDVYAREMLAVKTELPEDRIQVWFQ 213

  Fly   474 NQRAKMKKIQRKAKQNGGS 492
            |:|||.:|   :.|:.|||
Human   214 NRRAKWRK---REKRWGGS 229

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lmx1a	NP_729801.1	LIM1_Lmx1b	275..327	CDD:188757
		LIM	333..388	CDD:295319
		Homeobox	427..480	CDD:278475	21/52 (40%)
VSX1	NP_055403.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..37
		Octapeptide motif	31..38
		DNA_pol3_delta2	<47..>149	CDD:331068	33/84 (39%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	113..167		6/17 (35%)
		Nuclear localization signal. /evidence=ECO:0000255	161..166		1/4 (25%)
		Homeobox	167..220	CDD:306543	21/52 (40%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	290..365
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910