DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lmx1a and pou3f1

DIOPT Version :9

Sequence 1:	NP_729801.1	Gene:	Lmx1a / 39406	FlyBaseID:	FBgn0052105	Length:	640	Species:	Drosophila melanogaster
Sequence 2:	NP_571236.1	Gene:	pou3f1 / 30398	ZFINID:	ZDB-GENE-980526-372	Length:	368	Species:	Danio rerio

Alignment Length:	63	Identity:	20/63 - (31%)
Similarity:	31/63 - (49%)	Gaps:	2/63 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   420 GRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKI 482
            ||:  ::.||.:....:...:..|.:.|||.......||....|...||:|||.|:|.|.|::
Zfish   277 GRK--RKKRTSIEVGVKGALENHFLKCPKPSAHEITTLAGTLQLEKEVVRVWFCNRRQKEKRM 337

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lmx1a	NP_729801.1	LIM1_Lmx1b	275..327	CDD:188757
		LIM	333..388	CDD:295319
		Homeobox	427..480	CDD:278475	17/52 (33%)
pou3f1	NP_571236.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..28
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	69..88
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	100..134
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	147..193
		POU	187..261	CDD:197673
		Homeobox	282..335	CDD:278475	17/52 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R3844
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.030