DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and pou3f2b

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_571235.1 Gene:pou3f2b / 30397 ZFINID:ZDB-GENE-980526-370 Length:378 Species:Danio rerio


Alignment Length:168 Identity:34/168 - (20%)
Similarity:58/168 - (34%) Gaps:52/168 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PGSMTASS----------------GNSLHLSNSNNNLPTSISGNNSPTATASLTGQ--------- 75
            ||||..::                .||..||:::..:.....|...|.:::.|..|         
Zfish    23 PGSMQQATAYRDAQTLLQSDYSLQSNSHPLSHAHQWITALSHGEGGPWSSSPLGEQDIKPAVQSP 87

  Fly    76 -HQQHQQQQHQQQQQHPHQQHQQHQQQHAA----STTPVPINSCPTPTGHSPLSSSSS------- 128
             .:.|.....|.|.:.||..||.|...|.:    :||...|.|..|..|.|.:.|..|       
Zfish    88 RDEMHNSSNLQHQSRPPHLVHQTHGNHHDSRAWRTTTAAHIPSMATSNGQSLIYSQPSFSVNGLI 152

  Fly   129 ---------------NSNHNNNNNNNNGGSSSNNLHSA 151
                           :.:|::.:.:::|...|.:.|.:
Zfish   153 PGSGQGIHHHSMRDAHEDHHSPHLSDHGHPPSQHQHQS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475
pou3f2bNP_571235.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 4/4 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..118 9/31 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..205 4/40 (10%)
POU 200..274 CDD:197673
Homeobox 295..348 CDD:278475
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.