DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Hoxb13

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001100511.1 Gene:Hoxb13 / 303480 RGDID:1309113 Length:286 Species:Rattus norvegicus


Alignment Length:130 Identity:36/130 - (27%)
Similarity:54/130 - (41%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 LPLQKGEQFMLRDG---QLFCYRHDLEKEMFLAAAAA----QHCGFVGLDEEDLLRPRDG---RR 422
            ||:...:.:.|..|   |:.|.........|..||.|    ||            .|.||   ||
  Rat   165 LPVDSYQPWALAGGWNSQMCCQGEQNPPGPFWKAAFAEPSVQH------------PPPDGCAFRR 217

  Fly   423 GPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAK 487
            |.|: |...:..|.::.:..:..:....:..|..::..|.||.|.:.:||||:|.|.||:..|.|
  Rat   218 GRKK-RIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVK 281

  Fly   488  487
              Rat   282  281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 6/22 (27%)
Homeobox 427..480 CDD:278475 13/52 (25%)
Hoxb13NP_001100511.1 HoxA13_N 12..122 CDD:289085
HOX 218..274 CDD:197696 15/56 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.