DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and hoxb1a

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_571190.2 Gene:hoxb1a / 30337 ZFINID:ZDB-GENE-990415-101 Length:316 Species:Danio rerio


Alignment Length:386 Identity:83/386 - (21%)
Similarity:121/386 - (31%) Gaps:146/386 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 GPAATGSGNANGSGNGNGN---GNGN-----------GNG--------NGNGNG---GGAATASA 247
            ||..|  |:|:.|.|.:|.   |..|           .||        |..|.|   ||..|.|.
Zfish    37 GPFHT--GHASDSYNADGRLYVGGSNQPPTAAAQHQHQNGIYAHHQHQNQTGMGLTYGGTGTTSY 99

  Fly   248 AAASKLSADCSGRTEVGHIKCEKNFELCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQ---- 308
            ...:     |:......|    :.|...|..|...|... .:..:|:.|...:|..|||.|    
Zfish   100 GTQA-----CANSDYAQH----QYFINPEQDGMYYHSSG-FSTSNASPHYGSMAGAYCGAQGAVP 154

  Fly   309 ----LHHTCYVRNSKLYCKMDYDRLFGVKCSSCCHAIL-----PQELVMRPIPNFVFHLPCFVCY 364
                .||.|.        ..|:.|.:    |...:|.|     .::...:|.|...|        
Zfish   155 AAPYQHHGCE--------GQDHQRAY----SQGTYADLSASQGTEKDTDQPPPGKTF-------- 199

  Fly   365 ACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRP-R 428
                ...|.::...:.|::..|                     ||             ||:.. |
Zfish   200 ----DWMKVKRNPPKTGKVAEY---------------------GL-------------GPQNTIR 226

  Fly   429 TILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSG 493
            |..|::|..:.:..|..|....|..|..:|....|:...|::||||:|.|.||.:::        
Zfish   227 TNFTTKQLTELEKEFHFSKYLTRARRVEIAATLELNETQVKIWFQNRRMKQKKREKE-------- 283

  Fly   494 GGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSSGYLGGLDSTFASQPLNPNLPFSPD 554
                   |...:|:|..||..|:.|                  .||..|...:|    |||
Zfish   284 -------GLAPASSTSSKDLEDQSD------------------HSTSTSPEASP----SPD 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 14/59 (24%)
LIM 333..388 CDD:295319 9/59 (15%)
Homeobox 427..480 CDD:278475 17/53 (32%)
hoxb1aNP_571190.2 Homeobox 226..278 CDD:278475 17/51 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.