DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Lhx2

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006234134.1 Gene:Lhx2 / 296706 RGDID:71076 Length:414 Species:Rattus norvegicus


Alignment Length:418 Identity:111/418 - (26%)
Similarity:153/418 - (36%) Gaps:130/418 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHH--TCYVRNSKLYCKMDY--------DR 328
            ||.|||.||.||:.:...|..||.:||.||.|.:.|..  ||:.::..:|||.||        .|
  Rat    52 LCAGCGGKISDRYYLLAVDKQWHMRCLKCCECKLNLESELTCFSKDGSIYCKEDYYSPSLHGPHR 116

  Fly   329 LFGV-KCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFC------- 385
            .|.| :|:.|...|...|:||| ..:.|:||.||.|..|...|..|:.|.::|..::|       
  Rat   117 RFSVQRCARCHLGISASEMVMR-ARDLVYHLNCFTCTTCNKMLTTGDHFGMKDSLVYCRLHFEAL 180

  Fly   386 --------YRHDLEKEMFLAAAAAQHCGF-------VGL-------------------------- 409
                    :.|........|||||:..|.       :||                          
  Rat   181 LQGEYPAHFNHADVAAAAAAAAAAKSAGLGSAGANPLGLPYYNGVGTVQKGRPRKRKSPGPGADL 245

  Fly   410 ------------DEEDLLR--PRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKD 460
                        |.|.|.|  |....:..||.||.....|.:..|:.|..:..|..|..:.||:.
  Rat   246 AAYNAALSCNENDAEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQK 310

  Fly   461 TGLSVRVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQEL 525
            |||:.||:||||||.|||.::                                     ..::|| 
  Rat   311 TGLTKRVLQVWFQNARAKFRR-------------------------------------NLLRQE- 337

  Fly   526 GGDSSGYLGGLDSTFASQPLNPNLPFSPDDYPANSNDSFCSSDLSLDGSNFDQLDDDADSLSLNN 590
                   ..|:|.| :...|....|..|....:|::.|..|:..:|         .|..|.:|..
  Rat   338 -------NTGVDKT-SDATLQTGTPSGPASELSNASLSPSSTPTTL---------TDLTSPTLPT 385

  Fly   591 LELQSTSSSGNQHSHS-HSNPHDMLANL 617
            :....||..||...|. ||.....|.||
  Rat   386 VTSVLTSVPGNLEGHEPHSPSQTTLTNL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 24/61 (39%)
LIM 333..388 CDD:295319 19/69 (28%)
Homeobox 427..480 CDD:278475 23/52 (44%)
Lhx2XP_006234134.1 LIM1_Lhx2 43..106 CDD:188853 23/53 (43%)
LIM2_Lhx2_Lhx9 119..177 CDD:188763 20/58 (34%)
COG5576 <255..386 CDD:227863 45/185 (24%)
Homeobox 278..331 CDD:395001 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.