DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Lhx9

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006249976.1 Gene:Lhx9 / 289048 RGDID:727956 Length:397 Species:Rattus norvegicus


Alignment Length:301 Identity:95/301 - (31%)
Similarity:130/301 - (43%) Gaps:63/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LCEGCGQKIHDRFLMNVGDANWHEQCLACCYCGMQLHH--TCYVRNSKLYCKMDYDRLFGV-KCS 335
            ||.|||.||.||:.:...|..||.:||.||.|.:.|..  ||:.::..:|||.||.|.|.| :|:
  Rat    70 LCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESELTCFAKDGSIYCKEDYYRRFSVQRCA 134

  Fly   336 SCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCYRH-------DLEKE 393
            .|...|...|:||| ..:.|:||.||.|..|...|..|:.|.::|..::|..|       :...:
  Rat   135 RCHLGISASEMVMR-ARDSVYHLSCFTCSTCNKTLTTGDHFGMKDSLVYCRAHFETLLQGEYPPQ 198

  Fly   394 MFLAAAAAQHCG-----FVGLDEEDLLRPRDGRRGP----------------------------- 424
            :.....||:..|     |.|.......|||. |:.|                             
  Rat   199 LSYTELAAKSGGLALPYFNGTGTVQKGRPRK-RKSPALGVDIVNYNSGCNENEADHLDRDQQPYP 262

  Fly   425 -----KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQR 484
                 ||.||.....|.:..|:.|..:..|..|..:.||:.|||:.||:||||||.|||.:: ..
  Rat   263 PSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRR-NL 326

  Fly   485 KAKQNGGSGGGSG----------SGRGTGNSSATDDKD-TN 514
            ..::|||.....|          ||..|...:||...| ||
  Rat   327 LRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 23/53 (43%)
LIM 333..388 CDD:295319 19/54 (35%)
Homeobox 427..480 CDD:278475 23/52 (44%)
Lhx9XP_006249976.1 LIM1_Lhx2 61..124 CDD:188853 23/53 (43%)
LIM2_Lhx2_Lhx9 129..187 CDD:188763 20/58 (34%)
Homeobox 271..324 CDD:395001 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.