DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and phx1

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_593776.1 Gene:phx1 / 2542405 PomBaseID:SPAC32A11.03c Length:942 Species:Schizosaccharomyces pombe


Alignment Length:232 Identity:53/232 - (22%)
Similarity:92/232 - (39%) Gaps:27/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   417 PRDG--RRGPKRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKM 479
            |..|  ...||..:..||:.|.......|.:...|...:||.:.::..:..|.|.:||||:|||.
pombe   157 PESGGSTSAPKSKKQRLTADQLAYLLREFSKDTNPPPAIREKIGRELNIPERSVTIWFQNRRAKS 221

  Fly   480 KKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDS--SGYLGGL------ 536
            |.|.|:.::.          |........:....|.|..:....|:...|  |.|:||:      
pombe   222 KLISRRQEEE----------RQRILREQRELDSLNQKVSQAFAHEVLSTSPTSPYVGGIAANRQY 276

  Fly   537 DSTFASQPLNPNLPFSPDDYPANSNDSFC--SSDL----SLDGSNFDQLDDDADSLSLNNLELQS 595
            .:|...:|......|.....|..|:...|  .||:    ||..:.::.|..:|..:| :..:..:
pombe   277 ANTLLPKPTRKTGNFYMKSGPMQSSMEPCIAESDIPIRQSLSSTYYNSLSPNAVPVS-SQRKYSA 340

  Fly   596 TSSSGNQHSHSHSNPHDMLANLNNSLINPIDKLYLMQ 632
            :|.|...::.|.||....:.:..:|...|:..:.:.|
pombe   341 SSYSAIPNAMSVSNQAFDVESPPSSYATPLTGIRMPQ 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 16/52 (31%)
phx1NP_593776.1 COG5576 116..272 CDD:227863 32/124 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I3555
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.