DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Bsx

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_839976.1 Gene:Bsx / 244813 MGIID:2669849 Length:232 Species:Mus musculus


Alignment Length:143 Identity:37/143 - (25%)
Similarity:54/143 - (37%) Gaps:35/143 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 PLQKGEQ----FMLRDGQ----LFCY-RHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGP 424
            ||.||:.    |:...|.    ||.: :|        |....:||                ||  
Mouse    72 PLHKGDHHHPYFLTTSGMPVPALFPHPQH--------AELPGKHC----------------RR-- 110

  Fly   425 KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAKQN 489
            ::.||:.:..|....:..|:.........|..||....||...|:.||||:|.|.||..||::..
Mouse   111 RKARTVFSDSQLSGLEKRFEIQRYLSTPERVELATALSLSETQVKTWFQNRRMKHKKQLRKSQDE 175

  Fly   490 GGSGGGSGSGRGT 502
            ..:..|..|..|:
Mouse   176 PKAADGPESPEGS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 8/27 (30%)
Homeobox 427..480 CDD:278475 16/52 (31%)
BsxNP_839976.1 Homeobox 114..167 CDD:395001 16/52 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..232 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.