DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and FHL2

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:113 Identity:34/113 - (30%)
Similarity:51/113 - (45%) Gaps:4/113 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 CEGCGQKIH-DRFLMNVGDANWHEQCLACCYCGMQLHHTCY-VRNSKLYCKMDYDRLFGVKCSSC 337
            ||.||:.|. |...::..|.:|||.|..|..|...|....: .:..:|.|...|...:..||..|
Human    40 CEECGKPIGCDCKDLSYKDRHWHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQEC 104

  Fly   338 CHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFC 385
            ...|:|....|. .....:|..||:|:.|:.|:.. :.|:.:|.|.||
Human   105 KKTIMPGTRKME-YKGSSWHETCFICHRCQQPIGT-KSFIPKDNQNFC 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 16/53 (30%)
LIM 333..388 CDD:295319 17/53 (32%)
Homeobox 427..480 CDD:278475
FHL2NP_001034581.1 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806 17/56 (30%)
LIM2_FHL2 101..157 CDD:188810 16/52 (31%)
LIM3_Fhl2 162..218 CDD:188815
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.