DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and FHL1

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:XP_006724806.1 Gene:FHL1 / 2273 HGNCID:3702 Length:339 Species:Homo sapiens


Alignment Length:198 Identity:46/198 - (23%)
Similarity:67/198 - (33%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KC--EKNFELCEGCGQKIHDRFLMNVGDAN-------WHEQCLACCYCGMQL-HHTCYVRNSKLY 321
            ||  .::...|:||.:.|      ..||.|       ||:.|..|..|...: ..:.:.:....|
Human   107 KCTTREDSPKCKGCFKAI------VAGDQNVEYKGTVWHKDCFTCSNCKQVIGTGSFFPKGEDFY 165

  Fly   322 CKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCY 386
            |...::..|...|..|..||....:..:..|   :|..||||..|...| .|::|...:.|.:|.
Human   166 CVTCHETKFAKHCVKCNKAITSGGITYQDQP---WHADCFVCVTCSKKL-AGQRFTAVEDQYYCV 226

  Fly   387 RHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCR 451
              |..|..     .|:.|.                 |.|.|.|...:..|.....|..:.|..|.
Human   227 --DCYKNF-----VAKKCA-----------------GCKNPITGKRTVSRVSHPVSKARKPPVCH 267

  Fly   452 KVR 454
            ..|
Human   268 GKR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 14/59 (24%)
LIM 333..388 CDD:295319 16/54 (30%)
Homeobox 427..480 CDD:278475 7/28 (25%)
FHL1XP_006724806.1 LIM <21..49 CDD:413332
LIM1_FHL1 56..109 CDD:188730 1/1 (100%)
LIM2_FHL1 117..174 CDD:188808 14/62 (23%)
LIM3_FHL1 178..230 CDD:188813 17/57 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.