Sequence 1: | NP_729801.1 | Gene: | Lmx1a / 39406 | FlyBaseID: | FBgn0052105 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006724806.1 | Gene: | FHL1 / 2273 | HGNCID: | 3702 | Length: | 339 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 46/198 - (23%) |
---|---|---|---|
Similarity: | 67/198 - (33%) | Gaps: | 44/198 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 267 KC--EKNFELCEGCGQKIHDRFLMNVGDAN-------WHEQCLACCYCGMQL-HHTCYVRNSKLY 321
Fly 322 CKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFVFHLPCFVCYACRLPLQKGEQFMLRDGQLFCY 386
Fly 387 RHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRTILTSQQRKQFKASFDQSPKPCR 451
Fly 452 KVR 454 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lmx1a | NP_729801.1 | LIM1_Lmx1b | 275..327 | CDD:188757 | 14/59 (24%) |
LIM | 333..388 | CDD:295319 | 16/54 (30%) | ||
Homeobox | 427..480 | CDD:278475 | 7/28 (25%) | ||
FHL1 | XP_006724806.1 | LIM | <21..49 | CDD:413332 | |
LIM1_FHL1 | 56..109 | CDD:188730 | 1/1 (100%) | ||
LIM2_FHL1 | 117..174 | CDD:188808 | 14/62 (23%) | ||
LIM3_FHL1 | 178..230 | CDD:188813 | 17/57 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |