DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Pou3f2

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_032925.1 Gene:Pou3f2 / 18992 MGIID:101895 Length:445 Species:Mus musculus


Alignment Length:197 Identity:56/197 - (28%)
Similarity:72/197 - (36%) Gaps:66/197 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PVGGSLYSLQQNHGGARFLDNPNPGSMTASSGNSLHLSNSNNNLPTSIS---------------- 61
            |.||    :||..||.|...:...|...|...|...||:::..: |::|                
Mouse    23 PPGG----MQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWI-TALSHGGGGGGGGGGGGGGG 82

  Fly    62 -----GNNSPTATASLTGQ------------------------HQQHQQQQHQQQQQHPHQQHQQ 97
                 |:.||.:|:.| ||                        .|||||||.|||||...||.||
Mouse    83 GGGGGGDGSPWSTSPL-GQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQQQQQQQ 146

  Fly    98 HQQQ--------HAASTTPVP-INSCPTPTGHSPLSSSSSNSN--HNNNNNNNNG----GSSSNN 147
            .|||        |||:..|.| .........|.|.|..:||..  ::..:...||    |.....
Mouse   147 QQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAG 211

  Fly   148 LH 149
            ||
Mouse   212 LH 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475
Pou3f2NP_032925.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..173 32/109 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..269 3/11 (27%)
POU 264..338 CDD:197673
Homeobox 359..413 CDD:395001
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..445
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.