DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Nkx2-6

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:170 Identity:49/170 - (28%)
Similarity:67/170 - (39%) Gaps:27/170 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   407 VGLDEEDLLR--PRDGRRGPKRPRTILTSQ-QRKQFKASFDQSPKPCRKVREALAKDTGLSVRVV 468
            ||....|:.|  |...|..|:|...:|.|| |....:..|.|........||.||....|:...|
Mouse   103 VGNLSGDMRRGGPVSTRTRPQRKSRVLFSQAQVLALERRFKQQRYLTAPEREHLASALQLTSTQV 167

  Fly   469 QVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSS--- 530
            ::||||:|.|.|. ||:.:....:|......|........|.|...|.:   |...||...:   
Mouse   168 KIWFQNRRYKSKS-QRQDQTLELAGHPLAPRRVAVPVLVLDGKPCLDPD---VAAFLGPYKATSP 228

  Fly   531 -----GYLG-GLDSTFASQ---------PLNP--NLPFSP 553
                 ||.| ..|:::||:         ||.|  :..|||
Mouse   229 YSCFGGYAGTPYDASYASRCTSASAGPGPLTPLASSGFSP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319
Homeobox 427..480 CDD:278475 18/53 (34%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 7/21 (33%)
Homeobox 126..179 CDD:278475 18/52 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.