Sequence 1: | NP_729801.1 | Gene: | Lmx1a / 39406 | FlyBaseID: | FBgn0052105 | Length: | 640 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032725.1 | Gene: | Nkx2-3 / 18089 | MGIID: | 97348 | Length: | 362 | Species: | Mus musculus |
Alignment Length: | 260 | Identity: | 61/260 - (23%) |
---|---|---|---|
Similarity: | 85/260 - (32%) | Gaps: | 94/260 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 365 ACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRT 429
Fly 430 ILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAK------- 487
Fly 488 --------------------------QNGGSGGGSGSGR---------GTGNSSA---------- 507
Fly 508 -----------------------TDDKDTNDKEDKCVKQELGGDS---SGYLGGLDSTFASQPLN 546
Fly 547 546 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lmx1a | NP_729801.1 | LIM1_Lmx1b | 275..327 | CDD:188757 | |
LIM | 333..388 | CDD:295319 | 6/22 (27%) | ||
Homeobox | 427..480 | CDD:278475 | 17/52 (33%) | ||
Nkx2-3 | NP_032725.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 126..149 | 8/28 (29%) | |
HOX | 145..201 | CDD:197696 | 17/55 (31%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 203..222 | 3/18 (17%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |