DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and Nkx2-3

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_032725.1 Gene:Nkx2-3 / 18089 MGIID:97348 Length:362 Species:Mus musculus


Alignment Length:260 Identity:61/260 - (23%)
Similarity:85/260 - (32%) Gaps:94/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 ACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCGFVGLDEEDLLRPRDGRRGPKRPRT 429
            ||..|.::.|:.:....|..|   .|:|.:    .||..|    ...||..||:.  |..::||.
Mouse    99 ACSGPKEQEEEVVSERSQKSC---QLKKSL----EAAGDC----KTSEDGERPKP--RSRRKPRV 150

  Fly   430 ILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSVRVVQVWFQNQRAKMKKIQRKAK------- 487
            :.:..|..:.:..|.|........||.||....|:...|::||||:|.|.|: ||:.|       
Mouse   151 LFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKR-QRQDKSLELGTH 214

  Fly   488 --------------------------QNGGSGGGSGSGR---------GTGNSSA---------- 507
                                      |..||..|.|:|.         |.|||:|          
Mouse   215 APPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPAYGYGNSAAAAAAAAAAAA 279

  Fly   508 -----------------------TDDKDTNDKEDKCVKQELGGDS---SGYLGGLDSTFASQPLN 546
                                   |....|...:..|  ...||.|   ...|||..|...:|||:
Mouse   280 AAAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPAC--SATGGGSFVNVSNLGGFGSGGGAQPLH 342

  Fly   547  546
            Mouse   343  342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 6/22 (27%)
Homeobox 427..480 CDD:278475 17/52 (33%)
Nkx2-3NP_032725.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..149 8/28 (29%)
HOX 145..201 CDD:197696 17/55 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..222 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.