DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and unc-97

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_508943.3 Gene:unc-97 / 180827 WormBaseID:WBGene00006826 Length:348 Species:Caenorhabditis elegans


Alignment Length:318 Identity:65/318 - (20%)
Similarity:91/318 - (28%) Gaps:142/318 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 GHIKCEKNFEL-----CEGCGQKIHDRFL--MNVGDANWHEQCLACCYCGMQL------------ 309
            |...||.:|.:     |..|.:.|..|.:  ||   |:||..|..|..|..||            
 Worm    66 GRKYCEHDFHVLFSPCCGKCNEFIVGRVIKAMN---ASWHPGCFCCEICNKQLADVGFLRNAGRA 127

  Fly   310 -------------H-----HTCYVR-----------------------------------NSKLY 321
                         |     |.|:..                                   |.:||
 Worm   128 LCRECNEREKAAGHGRYVCHKCHAMIDDGQHIKFRGDSFHPYHFKCKRCNNELTTASREVNGELY 192

  Fly   322 CKMDYDRLFGVKCSSCCHAILPQELVMRPIPNFV-------FHLPCFVCYACRLPLQKGEQFMLR 379
            |...:|.: |:.....||         |||...|       :|:..|||..|..|. .|.:...|
 Worm   193 CLRCHDTM-GIPICGACH---------RPIEERVIAALGKHWHVEHFVCSVCEKPF-LGHRHYER 246

  Fly   380 DGQLFCYRHDLEK---------------EMFLA-----AAAAQHCGFVG--LDEEDLLRPRDGRR 422
            .|..:|.:| ..|               |:|.|     ......|.|..  ||::......|   
 Worm   247 KGLPYCEQH-FHKLFGNLCFKCGDPCCGEVFQALQKTWCVKCFSCSFCDKKLDQKTKFYEFD--- 307

  Fly   423 GPKRPRTILTSQQRKQFKASFDQSPKPCRK-VREALAKDTGLSVRVVQVWFQNQRAKM 479
                        .:...|..:|:.|...:| :.|:| ||..:         :|||..|
 Worm   308 ------------MKPTCKRCYDRFPTELKKRISESL-KDRDV---------ENQRRSM 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757 21/118 (18%)
LIM 333..388 CDD:295319 16/61 (26%)
Homeobox 427..480 CDD:278475 12/54 (22%)
unc-97NP_508943.3 LIM1_PINCH 21..79 CDD:188717 4/12 (33%)
LIM2_PINCH 82..133 CDD:188718 14/53 (26%)
LIM3_PINCH 146..197 CDD:188719 6/50 (12%)
LIM4_PINCH 203..256 CDD:188720 17/63 (27%)
LIM5_PINCH 264..317 CDD:188721 9/67 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.