DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmx1a and DLX4

DIOPT Version :9

Sequence 1:NP_729801.1 Gene:Lmx1a / 39406 FlyBaseID:FBgn0052105 Length:640 Species:Drosophila melanogaster
Sequence 2:NP_612138.1 Gene:DLX4 / 1748 HGNCID:2917 Length:240 Species:Homo sapiens


Alignment Length:215 Identity:52/215 - (24%)
Similarity:70/215 - (32%) Gaps:71/215 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 PNFVFHLPC--FVCYACRLPLQKGEQFMLRDGQLFCYRHDLEKEMFLAAAAAQHCG-------FV 407
            ||..:..|.  .:.|....|...|      |..|.|.:.        ||.:...||       ..
Human    43 PNLSYSRPYGHLLSYPYTEPANPG------DSYLSCQQP--------AALSQPLCGPAEHPQELE 93

  Fly   408 GLDEEDLLRPRDGRRGP-------KRPRTILTSQQRKQFKASFDQSPKPCRKVREALAKDTGLSV 465
            ...|:..|.|....|.|       ::||||.:|.|.:.....|..:.......|..||...||:.
Human    94 ADSEKPRLSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQ 158

  Fly   466 RVVQVWFQNQRAKMKKIQRKAKQNGGSGGGSGSGRGTGNSSATDDKDTNDKEDKCVKQELGGDSS 530
            ..|::||||:|:|.||:   .|||.|...|...||                              
Human   159 TQVKIWFQNKRSKYKKL---LKQNSGGQEGDFPGR------------------------------ 190

  Fly   531 GYLGGLDSTFASQPLNPNLP 550
                    ||:..|.:|.||
Human   191 --------TFSVSPCSPPLP 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lmx1aNP_729801.1 LIM1_Lmx1b 275..327 CDD:188757
LIM 333..388 CDD:295319 9/37 (24%)
Homeobox 427..480 CDD:278475 19/52 (37%)
DLX4NP_612138.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..120 7/39 (18%)
Homeobox 120..173 CDD:306543 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.